beta-Amyloid Peptide (1-40) (human) (CAS 131438-79-4) (ab120479) | Abcam
Frontiers | Three Decades of Amyloid Beta Synthesis: Challenges and Advances
Amyloid beta: structure, biology and structure-based therapeutic development | Acta Pharmacologica Sinica
Making the final cut: pathogenic amyloid-β peptide generation by γ-secretase
Human beta-amyloid peptide (1-40) | C194H295N53O58S - PubChem
The redox chemistry of the Alzheimer's disease amyloid β peptide - ScienceDirect
APExBIO - Amyloid Beta-Peptide (1-40) (human)|Amyloid precursor protein|CAS# 131438-79-4
Key Residues for the Formation of Aβ42 Amyloid Fibrils | ACS Omega
Sequence alignment of IAPP and A-(1– 40). The sequence alignment of... | Download Scientific Diagram
Structure and sequence of the amyloid-b protein (Ab). (a) A typical 3D... | Download Scientific Diagram
β-Amyloid (1-42), human - GenScript
Amyloid-beta Peptides: How γ-secretase hits a moving target | eLife
Aβ(1-42) tetramer and octamer structures reveal edge conductivity pores as a mechanism for membrane damage | Nature Communications
Amyloid beta: structure, biology and structure-based therapeutic development | Acta Pharmacologica Sinica
Molecular insights into the surface-catalyzed secondary nucleation of amyloid-β40 (Aβ40) by the peptide fragment Aβ16–22 | Science Advances
Amino acid sequence of Alzheimer's A β , the 39-43 residue peptide... | Download Scientific Diagram
Are N- and C-terminally truncated Aβ species key pathological triggers in Alzheimer's disease? - ScienceDirect
Peptide and Protein Mimetics Inhibiting Amyloid β-Peptide Aggregation | Accounts of Chemical Research
Refining the amyloid β peptide and oligomer fingerprint ambiguities in Alzheimer's disease: Mass spectrometric molecular characterization in brain, cerebrospinal fluid, blood, and plasma - Michno - 2021 - Journal of Neurochemistry - Wiley Online Library
beta Amyloid (1-40) Polyclonal Antibody (44-136)
Amyloid Beta Peptides
Dominance of Amyloid Precursor Protein Sequence over Host Cell Secretases in Determining β-Amyloid Profiles Studies of Interspecies Variation and Drug Action by Internally Standardized Immunoprecipitation/Mass Spectrometry | Journal of Pharmacology and ...
Frontiers | The Beta Amyloid Dysfunction (BAD) Hypothesis for Alzheimer's Disease
IJMS | Free Full-Text | Development and Technical Validation of an Immunoassay for the Detection of APP669–711 (Aβ−3–40) in Biological Samples
Stabilization of a β-hairpin in monomeric Alzheimer's amyloid-β peptide inhibits amyloid formation | PNAS
beta-Amyloid (1-40), human - peptide sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV | Genaxxon bioscience - online shop
Complete aggregation pathway of amyloid β (1-40) and (1-42) resolved on an atomically clean interface | Science Advances
